Protein Info for RALBFv3_RS20310 in Ralstonia solanacearum IBSBF1503

Annotation: pyridoxamine 5'-phosphate oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00558: pyridoxamine 5'-phosphate oxidase
  • amino acids 25 to 217 (193 residues), 212 bits, E=4e-67
• PF01243: Putative_PNPOx
  • amino acids 41 to 124 (84 residues), 86.3 bits, E=2e-28
• PF12766: Pyridox_oxase_2
  • amino acids 43 to 118 (76 residues), 28.9 bits, E=2.3e-10
• PF10590: PNP_phzG_C
  • amino acids 177 to 219 (43 residues), 58.9 bits, 5.5e-20

Best Hits

Swiss-Prot: 91% identical to PDXH2_RALSO: Pyridoxine/pyridoxamine 5'-phosphate oxidase 2 (pdxH2) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00275, pyridoxamine 5'-phosphate oxidase [EC: 1.4.3.5] (inferred from 91% identity to rsl:RPSI07_mp0579)

Predicted SEED Role

"Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.4.3.5)

MetaCyc Pathways

• pyridoxal 5'-phosphate biosynthesis I (6/7 steps found)
• pyridoxal 5'-phosphate salvage II (plants) (5/9 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (7/12 steps found)
• pyridoxal 5'-phosphate salvage I (2/6 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (2/8 steps found)

KEGG Metabolic Maps

• Vitamin B6 metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.3.5

Use Curated BLAST to search for 1.4.3.5

Protein Sequence (219 amino acids)

>RALBFv3_RS20310 pyridoxamine 5'-phosphate oxidase (Ralstonia solanacearum IBSBF1503)
MQPSVTMNATDMDTEAAFRNDHETLSGENPFAIFGEWLELAHRKEINDANAMALATAGPD
GLPNVRMVLLKGFDSEGFVFYTNTESQKGIELAENMQAAAVLHWKSLRRQVRFRGSVSRV
SAEEADTYFVSRARASRIGAWASKQSRPLETRAALAKSVAVEAARFGVGEIPRPAFWTGF
RIVPNCIEFWMDKPFRLHDRLVFKRSDAGHPWSALKLYP