Protein Info for RALBFv3_RS20075 in Ralstonia solanacearum IBSBF1503

Annotation: type VI secretion system protein ImpK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 210 to 229 (20 residues), see Phobius details TIGR03349: type IV/VI secretion system protein, DotU family" amino acids 32 to 237 (206 residues), 192.4 bits, see alignment E=4.3e-61 PF09850: DotU" amino acids 33 to 230 (198 residues), 199 bits, see alignment E=3.5e-63

Best Hits

KEGG orthology group: K11892, type VI secretion system protein ImpK (inferred from 94% identity to rsl:RPSI07_mp0652)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>RALBFv3_RS20075 type VI secretion system protein ImpK (Ralstonia solanacearum IBSBF1503)
MSATTTPSLFGGSAPAGNAAADAHDPNTHVRTLLDLLYDGFFMLFQLRNGQQPTSAEDFL
ARVRAFLEDFDRGAKRLNVSAEDVFDAKYAFCAAVDETILSSNFAIRTAWERRPLQLELF
GEQLAGETFFIKLEELRAHGAPRLQALEVFHMCLLLGFRGKYILEGPEKLAYLTARLGDE
ISAIKGKRAPFAPHWLLPDKVTHRLKRETPLWIFGAVFALIALLGYIGLSSTLRSKTNET
LEGYSQVVKLGPRFSHLTISLP