Protein Info for RALBFv3_RS19790 in Ralstonia solanacearum IBSBF1503

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00529: CusB_dom_1" amino acids 38 to 361 (324 residues), 35.6 bits, see alignment E=1.5e-12 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 40 to 376 (337 residues), 279.3 bits, see alignment E=1.8e-87 PF16576: HlyD_D23" amino acids 65 to 294 (230 residues), 48.2 bits, see alignment E=1.7e-16 PF13437: HlyD_3" amino acids 176 to 291 (116 residues), 30 bits, see alignment E=1.5e-10

Best Hits

Swiss-Prot: 58% identical to MEXA_PSEAE: Multidrug resistance protein MexA (mexA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03585, membrane fusion protein (inferred from 94% identity to rsl:RPSI07_mp0755)

MetaCyc: 53% identical to multidrug efflux pump membrane fusion lipoprotein AcrA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-1551; TRANS-RXN-1552; TRANS-RXN-354; TRANS-RXN-355; TRANS-RXN-356; TRANS-RXN-357; TRANS-RXN-359; TRANS-RXN-360; TRANS-RXN0-592

Predicted SEED Role

"RND efflux system, membrane fusion protein CmeA" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (409 amino acids)

>RALBFv3_RS19790 efflux RND transporter periplasmic adaptor subunit (Ralstonia solanacearum IBSBF1503)
MRSIPHALPPLLAALAAASLLAACGKPPGGPPPAEGTPVVGVMTVQPQRVTLDTELPGRT
VPFLVADVRPQVNGIIKARRFREGSDVKAGEALYQIDPATYRAAYDSNVAALAKAQANLK
STRLKAERYKELVSIQAVSRQDYDDAAAALAQGEADVAAARANVETSRINLAYARVDAPI
SGRIGRSSVTPGALVTANQTTSLATVQQLDPIYVDVTQPSAALLRLRQAMARGDLQKSGA
NAAAVQLLLEDGSTYPLAGKLEFSDVTVDQNTGSVTLRAVFPNPNAILLPGMYVRAVLQE
GVKDEALLVPQQAVARDSTGKPFAYVVGGDRKLQRRALETERTVGDQWLVRSGLRVGDQL
VVEGLPRAVPGAEVKTTPWTGKTATSSPAAPTPPAVQTAVKPPATIAAN