Protein Info for RALBFv3_RS19740 in Ralstonia solanacearum IBSBF1503

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 59 to 83 (25 residues), see Phobius details amino acids 92 to 136 (45 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 258 to 281 (24 residues), see Phobius details amino acids 294 to 319 (26 residues), see Phobius details amino acids 331 to 348 (18 residues), see Phobius details amino acids 354 to 375 (22 residues), see Phobius details amino acids 387 to 411 (25 residues), see Phobius details amino acids 417 to 439 (23 residues), see Phobius details PF00083: Sugar_tr" amino acids 21 to 206 (186 residues), 24.8 bits, see alignment E=1e-09 PF07690: MFS_1" amino acids 30 to 320 (291 residues), 178.5 bits, see alignment E=1.8e-56 TIGR00893: D-galactonate transporter" amino acids 32 to 439 (408 residues), 498.5 bits, see alignment E=6.7e-154

Best Hits

Swiss-Prot: 60% identical to GARP_ECOLI: Probable galactarate transporter (garP) from Escherichia coli (strain K12)

KEGG orthology group: K03535, MFS transporter, ACS family, glucarate transporter (inferred from 96% identity to rsl:RPSI07_mp0772)

MetaCyc: 60% identical to galactarate/D-glucarate transporter GarP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-203; TRANS-RXN0-204; TRANS-RXN0-523

Predicted SEED Role

"D-glucarate permease" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>RALBFv3_RS19740 MFS transporter (Ralstonia solanacearum IBSBF1503)
MEIKAPAMGARSVPRAERISRVRFMILAMLFIVTTINYADRATISMAGPAMQKDLGIDAV
SLGYIFSAFGWAYVIAQIPGGWLLDRFGSKRVYTFSILLWSLFTLMQGTIGFFTGAAAIA
MVFCLRFMVGVAEAPSFPANSRIVAAWFPANERGTASAIFNSAQYAATVVFAPLMAWLVH
TFGWHYVFIVMGAIGIVMAIAWRLFVHDPKDHPRITRAEIEYIEAGGGLVNMDRAGVAKT
EGPDVGYIKQLLKNRMLMGVYIAQYCINALTYFFITWFPVYLVQARGMSILKAGFVASIP
AVCGFLGGILGGLVSDALLRRGASLSVARKVPIVLGMLLSMSMVICNYVDAQAIVVALMA
LSFFGKGLGALGWAVNSDTAPKQIAGLSGALMNTFGNLSSITTPIAIGYIVNTTGSFNGA
LVYVGIHALVACLCYLVMVGEIKRVELKPL