Protein Info for RALBFv3_RS19180 in Ralstonia solanacearum IBSBF1503

Annotation: rhomboid family intramembrane serine protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 48 to 71 (24 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 111 to 130 (20 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details amino acids 169 to 190 (22 residues), see Phobius details PF01694: Rhomboid" amino acids 45 to 192 (148 residues), 114.3 bits, see alignment E=2.7e-37

Best Hits

KEGG orthology group: None (inferred from 92% identity to rso:RS02331)

Predicted SEED Role

"integral membrane rhomboid family serine protease MJ0610.1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (197 amino acids)

>RALBFv3_RS19180 rhomboid family intramembrane serine protease (Ralstonia solanacearum IBSBF1503)
MISSLILANVIVFVAELFAGDTLLRSFALWPPGVAGIDAGGGFFPWQLLTYAFLHASVPH
LVFNMFGMFMFGRDVERTLGRVRTGVLYVASVLSAAFTQIAVMGLSTIPAGPIVGASGGV
FGLLLAYAVLFPRRMILLLFPPIPMPAWLFATVYALIELTLGLSGSAGHIAHFAHLGGMA
GSGVLLWRWLRRRADLS