Protein Info for RALBFv3_RS18655 in Ralstonia solanacearum IBSBF1503

Annotation: PTS sugar transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 transmembrane" amino acids 113 to 134 (22 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details amino acids 216 to 233 (18 residues), see Phobius details amino acids 246 to 271 (26 residues), see Phobius details amino acids 291 to 310 (20 residues), see Phobius details amino acids 329 to 350 (22 residues), see Phobius details amino acids 362 to 383 (22 residues), see Phobius details amino acids 391 to 415 (25 residues), see Phobius details amino acids 430 to 452 (23 residues), see Phobius details TIGR01996: PTS system, sucrose-specific IIBC component" amino acids 2 to 449 (448 residues), 623.7 bits, see alignment E=1.8e-191 PF00367: PTS_EIIB" amino acids 9 to 41 (33 residues), 51.1 bits, see alignment (E = 7.2e-18) PF02378: PTS_EIIC" amino acids 111 to 397 (287 residues), 184.1 bits, see alignment E=3.6e-58

Best Hits

Swiss-Prot: 59% identical to PTSBC_KLEPN: PTS system sucrose-specific EIIBC component (scrA) from Klebsiella pneumoniae

KEGG orthology group: K02809, PTS system, sucrose-specific IIB component [EC: 2.7.1.69] K02810, PTS system, sucrose-specific IIC component (inferred from 95% identity to rsl:RPSI07_mp1102)

MetaCyc: 59% identical to Enzyme IIscr (Klebsiella pneumoniae)
SUCROSEPHOSPHO-RXN [EC: 2.7.1.211]

Predicted SEED Role

"PTS system, sucrose-specific IIB component (EC 2.7.1.69) / PTS system, sucrose-specific IIC component (EC 2.7.1.69)" in subsystem Sucrose utilization (EC 2.7.1.69)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.211 or 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (465 amino acids)

>RALBFv3_RS18655 PTS sugar transporter (Ralstonia solanacearum IBSBF1503)
MNEQETAQALLPLLGGPDNVVSLAHCATRLRLVVRDMAKVDHGAIGALALVKGSFSNAGQ
VQIVVGQGTVNRVHDALQPLLGAPAATSLEDVKREATARLNPVQRLARALSDIFVPIIPV
IVASGLLMGVLGGLRSMGWAEGSNALFQIADIFASTAFVFLPILIAFSAGKSFGVSPFLA
AALAGILIHPALQNAWTLGSGVREYWDLFGLSVAKVGYQGTVLPVLFAVWIMARVERLVR
RVVPTAVDLIFTPFLTLLISGAIALTVVGPLGRALGDALSFGLQWVYQHGGPLAGLVFGG
LYSAIVVTGVHHSFHAIEAGLLANPSIGVNFLLPIWSMANIAQGGAALAVFSLSRDDKIR
QIALPAALSCLMGITEAAIFGVNLRFFRPFIAAALGGAVAGGWVVATHVGMSGIALTGFP
GLAIVQPDSLVNYLIGAGIAFSLAFVCTRLSYLKAAVPLGEKSGA