Protein Info for RALBFv3_RS18425 in Ralstonia solanacearum IBSBF1503

Annotation: trehalose-phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00685: trehalose-phosphatase
  • amino acids 22 to 254 (233 residues), 193.4 bits, E=6.2e-61
• PF05116: S6PP
  • amino acids 25 to 218 (194 residues), 23.6 bits, E=5.5e-09
• TIGR01484: HAD hydrolase, family IIB
  • amino acids 26 to 220 (195 residues), 74.7 bits, E=1.1e-24
• PF02358: Trehalose_PPase
  • amino acids 27 to 237 (211 residues), 150.1 bits, E=8.5e-48

Best Hits

Swiss-Prot: 45% identical to OTSB_SALTS: Trehalose-phosphate phosphatase (otsB) from Salmonella typhimurium (strain SL1344)

KEGG orthology group: K01087, trehalose-phosphatase [EC: 3.1.3.12] (inferred from 90% identity to rsl:RPSI07_mp1145)

Predicted SEED Role

"Trehalose-6-phosphate phosphatase (EC 3.1.3.12)" in subsystem Trehalose Biosynthesis (EC 3.1.3.12)

MetaCyc Pathways

• trehalose biosynthesis I (2/2 steps found)
• trehalose biosynthesis II (1/2 steps found)
• trehalose biosynthesis III (1/2 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (4/8 steps found)
• mycolate biosynthesis (25/205 steps found)
• superpathway of mycolate biosynthesis (26/239 steps found)

KEGG Metabolic Maps

• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.12

Protein Sequence (262 amino acids)

>RALBFv3_RS18425 trehalose-phosphatase (Ralstonia solanacearum IBSBF1503)
MPQIASPASSAHAAPLPPLDPARTAFLLDFDGTLVDIAPQPDAVHVSPDLRTALAALQRA
SDGALAVVSGRTVADIEARLALPGLVIAGVHGAERRHADGSFHQLRTDGEALAALERELR
AQLPSVPGVVLESKGIAFALHYRHLPQAADAVRALAQRLADRYAEHVRLQAGKMVVELKP
RGASKGEVVRHLMERAPFAGRIALFAGDDLTDESAFEAVNALGGWSLKVGAGPSQAHWRV
PDPAALRGWLAALARHAGGPAA