Protein Info for RALBFv3_RS18290 in Ralstonia solanacearum IBSBF1503

Annotation: bifunctional diguanylate cyclase/phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 914 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13185: GAF_2" amino acids 187 to 331 (145 residues), 55.4 bits, see alignment E=2.9e-18 TIGR00229: PAS domain S-box protein" amino acids 340 to 473 (134 residues), 41.4 bits, see alignment E=1.4e-14 PF13426: PAS_9" amino acids 355 to 465 (111 residues), 23.2 bits, see alignment E=2.4e-08 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 473 to 636 (164 residues), 139 bits, see alignment E=1.2e-44 PF00990: GGDEF" amino acids 477 to 634 (158 residues), 164.2 bits, see alignment E=7.9e-52 PF00563: EAL" amino acids 655 to 889 (235 residues), 239.6 bits, see alignment E=1.1e-74

Best Hits

KEGG orthology group: None (inferred from 94% identity to rsl:RPSI07_mp1185)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (914 amino acids)

>RALBFv3_RS18290 bifunctional diguanylate cyclase/phosphodiesterase (Ralstonia solanacearum IBSBF1503)
MTRFTPALAGAHPAVAVLAPEPAARPADQPLAATPTDAAEFAVLARLSADAVLVAVDGRI
VQGNQAALHLLVAPAPERLVGVELASLIHPDDAGQVMPRLSGIAAGSLPAEPIEHRLVRA
DFTHVLVTSEAARCTHAGQPAVMLVLREAGSRHALERNTVQARAEALHARRLLASENAVL
AQLASNASLSTVLRHLCLYVEQIYPDAMSAVLLLDAESRTLRVAAAPTLPAAYAGTLEGS
PIGPDAGACGCAAYLGEAALIGEIATDPRWQHERTAALAAGFAAAWALPIRSSRGDKLGV
LALFYRQPGLPTEEAQRFLDDITHLAGVAIQKDTTERGLAESEERYRLAVSHLNEGVLIQ
ALDGVVLAANASAERILRVRSGQLVGRNRFDMMQRVVDEHGKDVALDALPSKLVRQSGEP
ILGRIYGLLLKTGELIWARMNIIPIRRHGDVAPTSIMLSFADITDFKRAEQRLRHLASHD
ALTGLTNRSFFIAHLDSAIERARDESRELALFFLDLDRFKSVNDTAGHACGDTLLQSAAA
RLTDCIGPGDVIARLGGDEFVILIEQRVEGKRIAQLAERLLAAMREPFDTVNGRYYLGVS
IGVALYPHDGISGTDLLRSADAAMYRAKQNGRNRAQFYTAELNARLQRRYLLETALRDAR
DNSELQLVYQPKYDLASHRIVGAEALLRWNSVKLGAVSPVEFIPVAEETGLIVPIGEWVL
RRACEQAVAWYQALGYDFRMAVNLSARQFQTGDVVPMIEQTLAETGLPPTALEVEITESL
LMGGADEVRPMFDALTAQGIRISIDDFGTGYSSLSYLQRFPISNVKIDRSFILGIPSDPD
SVALTEAIVAMARALGMTVTAEGVEDADQVEFLAKAGCQEIQGYYIGKPVTADGFDRLLR
AHLAVVDAGVRAVL