Protein Info for RALBFv3_RS18125 in Ralstonia solanacearum IBSBF1503

Annotation: multidrug transporter subunit MdtA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 34 to 54 (21 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 79 to 407 (329 residues), 244.6 bits, see alignment E=6.6e-77 PF13533: Biotin_lipoyl_2" amino acids 104 to 152 (49 residues), 57.9 bits, see alignment 1e-19 PF16576: HlyD_D23" amino acids 104 to 326 (223 residues), 46.3 bits, see alignment E=4.9e-16 PF13437: HlyD_3" amino acids 215 to 317 (103 residues), 30.2 bits, see alignment E=9.7e-11

Best Hits

Swiss-Prot: 51% identical to MDTA_YERPB: Multidrug resistance protein MdtA (mdtA) from Yersinia pseudotuberculosis serotype IB (strain PB1/+)

KEGG orthology group: K07799, putative multidrug efflux transporter MdtA (inferred from 94% identity to rsl:RPSI07_mp1228)

MetaCyc: 48% identical to multidrug efflux pump membrane fusion protein MdtA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-352; TRANS-RXN-353; TRANS-RXN-92

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>RALBFv3_RS18125 multidrug transporter subunit MdtA (Ralstonia solanacearum IBSBF1503)
MSDAMDPKPGTPYAGHDTVSPTLLPPRAGKPRRWILWVALVVLALIGYAVFHAVQRSTGA
GKGGPGGRGAAMAGKPMPVMVATAAKGDINVVLTALGNVTPVNNVTVKTRVDGQLVRLAF
TEGQTVKAGDLLAEIDPRAYQAQLAQAEGQLARDSALLQNARLDLQRYQTLMAQDSIAKQ
QVDTQASLVRQYEGTVKLDQGNADNARVQLSYTRITAPVSGRVGLRQVDPGNIVHASDTT
GIVVITQIDPITVIYTLPEDTLPKVMPRLQAGDKLPVEAWDRGQTNLLAHGTLMTVDNTI
DNTTGTVKLRAQFPNQNAALFPNQFVNVRMRVDTLHDQVILPGAAIQRGTQGTFVYAVGA
DGNVALRIVKLGATEGDRVSIAQGLNPGERVVIDGADKLRDGSPVEVIQPDAGPASAPAT
AQGSHGAQGGHRRHGGASAPTAAQP