Protein Info for RALBFv3_RS17955 in Ralstonia solanacearum IBSBF1503

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 PF12146: Hydrolase_4" amino acids 32 to 125 (94 residues), 32 bits, see alignment E=1.6e-11 PF00561: Abhydrolase_1" amino acids 34 to 167 (134 residues), 77.4 bits, see alignment E=2.8e-25 PF12697: Abhydrolase_6" amino acids 35 to 255 (221 residues), 76.6 bits, see alignment E=9e-25 PF00756: Esterase" amino acids 104 to 125 (22 residues), 23.7 bits, see alignment (E = 7.2e-09)

Best Hits

KEGG orthology group: None (inferred from 90% identity to rsl:RPSI07_mp1258)

Predicted SEED Role

"probable hydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (272 amino acids)

>RALBFv3_RS17955 alpha/beta hydrolase (Ralstonia solanacearum IBSBF1503)
MRAQGEFADVRLPLVVDGTALDIAALHRPGDRAPILFLHGFGSTKEDYADIGRHAAFDGR
PCIAYDAPGCGETRCADLARISIPFLVGTAAAVLDHFGIRTFHLVGHSMGGLTALMLASQ
WPDRVLSFTDIEGNLAPEDCFLSRQIVDYPEADAERFFDGFIERTRHAPAYASALYAASL
RHKVRAGAVRGIFESMVDLSDNGDLMARFLGLPCPKLFMYGEQNASLSYLRHIRAHGVEL
AEIPACGHFPMYSNPVLMWERIAGFQAGACTG