Protein Info for RALBFv3_RS17840 in Ralstonia solanacearum IBSBF1503

Annotation: cytochrome ubiquinol oxidase subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 129 to 150 (22 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details amino acids 219 to 236 (18 residues), see Phobius details amino acids 317 to 339 (23 residues), see Phobius details amino acids 351 to 373 (23 residues), see Phobius details amino acids 405 to 427 (23 residues), see Phobius details PF01654: Cyt_bd_oxida_I" amino acids 8 to 429 (422 residues), 523 bits, see alignment E=2.3e-161

Best Hits

KEGG orthology group: K00425, cytochrome bd-I oxidase subunit I [EC: 1.10.3.-] (inferred from 94% identity to rso:RS03186)

Predicted SEED Role

"Cytochrome d ubiquinol oxidase subunit I (EC 1.10.3.-)" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases (EC 1.10.3.-)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (462 amino acids)

>RALBFv3_RS17840 cytochrome ubiquinol oxidase subunit I (Ralstonia solanacearum IBSBF1503)
MPLDPVVLARIQFGANITFHILFPTISIALAWVLLFFKLRYRRTGDAAWMAAYRLWVKVF
ALTFALGVVSGVTMSFQFGTNWPGYMNTVGNIAGPLLAYEVLTAFFLEASFLGIMLFGTG
RVSERIHTLATFLVALGTTISVFWIIALNSWMQTPAGYVMIDGRAHPASWLAIIFNPSFP
YRFTHMLLASGLTVSFLLAGLSAYRWLRHDRAADVRATLKTGVVLAAALIPLQIAAGDAH
GLNTLEHQPAKLAAMEGIWQTERGVPAVLFGLPDEATRSNRFEIAVPKLASLYLRHTLDG
EVQGLEAFEHHPPVAPVFFAFRLMVGVGLLMLAVSWASAWRLRRGGELPRWLARVLVAMT
FSGWVAVVAGWYITEIGRQPWLVYGVLTTAQAASAVPARMIGSTLAMYLALYAFLIASYV
AVVFYLARKAGGAIDPTDEDAAGMPIIETPAPLLATPARSPA