Protein Info for RALBFv3_RS17815 in Ralstonia solanacearum IBSBF1503

Annotation: bifunctional DNA-binding transcriptional dual regulator/O6-methylguanine-DNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 PF12833: HTH_18" amino acids 33 to 111 (79 residues), 70.5 bits, see alignment E=2.4e-23 PF06445: GyrI-like" amino acids 128 to 276 (149 residues), 81.3 bits, see alignment E=2e-26 PF14526: Cass2" amino acids 141 to 274 (134 residues), 47.1 bits, see alignment E=6e-16

Best Hits

KEGG orthology group: K13652, AraC family transcriptional regulator (inferred from 89% identity to rsl:RPSI07_mp1282)

Predicted SEED Role

"PROBABLE TRANSCRIPTION REGULATOR PROTEIN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>RALBFv3_RS17815 bifunctional DNA-binding transcriptional dual regulator/O6-methylguanine-DNA methyltransferase (Ralstonia solanacearum IBSBF1503)
MKPSTARSYGQRIARVVEAILANPGAPHTVESLAAVAHLSPYHFHRIYRALTGESIAATV
QRVRLARAAHRLTGVGEPVSTVALDVGYDSPQAFARAFRGFAGVSPSAFHARQQSLSSAP
TGTGVPHVELIELAPIEVVCLRHDGPVATIGQTFRTLMQTLHAGQTLPDTPDRIGICHGD
PELRDTFRYDAAAVPPAQGLPPDSLERARIEGGLYACHRLVGPYALIAPTFEALFGGWLP
HSGYAPDDRPALEFYRSPPSPTQRRDCETDLLIPLRKD