Protein Info for RALBFv3_RS17745 in Ralstonia solanacearum IBSBF1503

Annotation: sulfite exporter TauE/SafE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 21 to 57 (37 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 101 to 121 (21 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 165 to 187 (23 residues), see Phobius details amino acids 197 to 221 (25 residues), see Phobius details amino acids 229 to 250 (22 residues), see Phobius details amino acids 255 to 279 (25 residues), see Phobius details PF01925: TauE" amino acids 29 to 276 (248 residues), 137 bits, see alignment E=4.2e-44

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 96% identity to rso:RS05309)

Predicted SEED Role

"FIG00975449: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (283 amino acids)

>RALBFv3_RS17745 sulfite exporter TauE/SafE family protein (Ralstonia solanacearum IBSBF1503)
MTASRRTGTLSGAPPFCFPHLSTMLFLFLLAGLTAGFFAGMFGIGGGAIVIPILVHVYRD
AGMDMTEAIRLAFGTSLATMAFTGLSSYLSHRQRGNVDGAWLRKLMLPSGLGALVGGIIA
ARIPGGWLALGLALMLGYFGIKLLVQRSDAVATWPWLERYRHVAGFLSGLTYSLAGMGGA
SVVTFYLTKAGLSLRSAIGTATGVILPISVGAILGFGLTAGAPHDWRWGYIDLRALLALS
VCSIVASKLGVKTAAWLPVAVLRKGFGFFMFVLAGKTLLGTLS