Protein Info for RALBFv3_RS17520 in Ralstonia solanacearum IBSBF1503

Annotation: sulfonate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details TIGR01728: ABC transporter, substrate-binding protein, aliphatic sulfonates family" amino acids 44 to 326 (283 residues), 242 bits, see alignment E=3.9e-76 PF13379: NMT1_2" amino acids 44 to 262 (219 residues), 49.9 bits, see alignment E=9.7e-17 PF04069: OpuAC" amino acids 67 to 257 (191 residues), 29.9 bits, see alignment E=1.1e-10 PF12974: Phosphonate-bd" amino acids 70 to 217 (148 residues), 38.7 bits, see alignment E=2e-13 PF00497: SBP_bac_3" amino acids 70 to 253 (184 residues), 30 bits, see alignment E=9.6e-11 PF09084: NMT1" amino acids 85 to 262 (178 residues), 56.1 bits, see alignment E=1.3e-18

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 95% identity to rsl:RPSI07_mp1371)

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>RALBFv3_RS17520 sulfonate ABC transporter substrate-binding protein (Ralstonia solanacearum IBSBF1503)
MQAPSPHAYATPFPRRRRWLATLLGAGLALCGGMALAADPGGTVRIGFQKAGLLAVLKAQ
GSLDKPLADLGYRIEWKEFPAGPQLLEALNVGSVDFGYTGAPPAVFAQAAGAQFVYVGAE
PGAITNEALFVLDGSPARSVADLKGKRIALQKGSSSNYLLVQLLKRANLTVQDIQPIYLP
PAEARAAFESGAVDAWVVWDPYYALAQKALKVRTLADYTGLPSPFNFYEATPGFVQAHPR
AVNALLAQLRATGLWVNRHPQETAALLSPRLGIEQPVVETWLRRVPYGVTPITPEVIAAQ
QQVADLFHQQKLIPRPVSVQGAVWRASFPVAAD