Protein Info for RALBFv3_RS17510 in Ralstonia solanacearum IBSBF1503

Annotation: YggT family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 65 to 88 (24 residues), see Phobius details amino acids 90 to 139 (50 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details PF02325: YGGT" amino acids 11 to 80 (70 residues), 52.3 bits, see alignment E=3e-18 amino acids 109 to 172 (64 residues), 59.8 bits, see alignment E=1.4e-20

Best Hits

KEGG orthology group: K02221, YggT family protein (inferred from 93% identity to rso:RS02073)

Predicted SEED Role

"Integral membrane protein YggT, involved in response to extracytoplasmic stress (osmotic shock)" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (183 amino acids)

>RALBFv3_RS17510 YggT family protein (Ralstonia solanacearum IBSBF1503)
MFGDITRFLLDTLFTLFGAALLLRAWTQAVRLSPRNPLSQAIFQLTGWLVHPLRRIIPAT
GYIDWSSLLAAYLTALVYLLLLVASLGASPLGLLPLGFLAALFTVLKWGFNVLVWITIGS
AILSWVAPHAPMGAVLNTLIDPLLRPIRRLLPPLGGLDLSPLVLLVVAQVVVIALSHAYP
MFL