Protein Info for RALBFv3_RS17405 in Ralstonia solanacearum IBSBF1503

Annotation: chemotaxis protein CheR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 PF03705: CheR_N" amino acids 22 to 72 (51 residues), 63.1 bits, see alignment 4e-21 PF01739: CheR" amino acids 89 to 274 (186 residues), 193.3 bits, see alignment E=7.9e-61

Best Hits

Swiss-Prot: 54% identical to CHER_SALTY: Chemotaxis protein methyltransferase (cheR) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00575, chemotaxis protein methyltransferase CheR [EC: 2.1.1.80] (inferred from 97% identity to rsl:RPSI07_mp1393)

MetaCyc: 53% identical to chemotaxis protein methyltransferase (Escherichia coli K-12 substr. MG1655)
Protein-glutamate O-methyltransferase. [EC: 2.1.1.80]; 2.1.1.- [EC: 2.1.1.80]

Predicted SEED Role

"Chemotaxis protein methyltransferase CheR (EC 2.1.1.80)" in subsystem Bacterial Chemotaxis (EC 2.1.1.80)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.80

Use Curated BLAST to search for 2.1.1.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (292 amino acids)

>RALBFv3_RS17405 chemotaxis protein CheR (Ralstonia solanacearum IBSBF1503)
MAQTLAPVSPTLASREFSFTAADFARIRDLIYRRVGISLSDRKSEMVYSRLARRLRVVNI
ASFRDYLDALENGHLPEEWEAFTNALTTNLTAFFREQHHFPLLAEHAKAKRAPFSVWCSA
SSTGEEPYSIAITLAETFGSMSPGQVSVVASDVDTSALARARAGIYPMERVSALSADRLK
KYFLRGTGKQEGYARVRPELQAMIDFRQINLLDRDWPLTQKFDVIFCRNVMIYFDKPTQA
KILEHFVDVMKPDGLLFAGHSESFLQVTKAWSLRGKTVYEIAPEIRAKLGAR