Protein Info for RALBFv3_RS16920 in Ralstonia solanacearum IBSBF1503

Annotation: EamA/RhaT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 29 to 47 (19 residues), see Phobius details amino acids 59 to 76 (18 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details amino acids 116 to 138 (23 residues), see Phobius details amino acids 147 to 165 (19 residues), see Phobius details amino acids 177 to 199 (23 residues), see Phobius details amino acids 211 to 228 (18 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details amino acids 268 to 287 (20 residues), see Phobius details amino acids 293 to 311 (19 residues), see Phobius details PF00892: EamA" amino acids 29 to 160 (132 residues), 61.2 bits, see alignment E=6.7e-21 amino acids 180 to 307 (128 residues), 56.5 bits, see alignment E=1.9e-19

Best Hits

KEGG orthology group: None (inferred from 35% identity to cti:RALTA_A0159)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>RALBFv3_RS16920 EamA/RhaT family transporter (Ralstonia solanacearum IBSBF1503)
MHTIRDMKLTTPISSASTVDPHAIRNERIGTLLMVFGGIVLGTIGIFIEEAGQDPVTTVL
FRCGFGGVALLLWGLMEGRIAELRLTGRALRSAIAAGLLMVVNWGLFFAAIPRTSIAVAT
VIFHVQPFWVIALGAWLLRERISAQRAAATVIALFGLVLATGLLNGGNPLHSGMAAGYWS
GVAMCLGGSVAYAGVTLIARMTTQVSPFAQAWWQCLVGVAVTSWWPFVHGVPGFGSAWGW
LAGMGVIHTGLAYAVLYAGMSRLRTGNLALLQFVYPLTAILVDRVVYGHTLSPMQIVGMS
LMAASLWSVKLMR