Protein Info for RALBFv3_RS16765 in Ralstonia solanacearum IBSBF1503

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 649 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 181 to 205 (25 residues), see Phobius details PF13675: PilJ" amino acids 43 to 141 (99 residues), 74.1 bits, see alignment E=3.4e-24 PF00672: HAMP" amino acids 198 to 248 (51 residues), 50.9 bits, see alignment 5.7e-17 PF13185: GAF_2" amino acids 287 to 428 (142 residues), 47.5 bits, see alignment E=7.7e-16 PF07730: HisKA_3" amino acids 444 to 510 (67 residues), 47.2 bits, see alignment E=9.3e-16 PF02518: HATPase_c" amino acids 553 to 644 (92 residues), 44 bits, see alignment E=9.5e-15

Best Hits

KEGG orthology group: K07673, two-component system, NarL family, nitrate/nitrite sensor histidine kinase NarX [EC: 2.7.13.3] (inferred from 93% identity to rsl:RPSI07_mp1503)

Predicted SEED Role

"Nitrate/nitrite sensor protein (EC 2.7.3.-)" in subsystem Nitrate and nitrite ammonification (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (649 amino acids)

>RALBFv3_RS16765 histidine kinase (Ralstonia solanacearum IBSBF1503)
MIALSDTFPTRLPPFWRRLSTRIVTVSLDAATLVLIVIAGTLWLSWQLEGAGAAINDTGS
LRMRASQIGIAVLEARNGRGNTLDTQIAQLDATLATLRHGDAQRPLFLPNDPDIRRQLDI
VMAYWTTQLKPRASTERAQQTGMPSAYLAYLPGFIQEADQLVRMIERSNARKTTLLRSSQ
FVLAAMACIGTLLMIYLLYLWIILPVLRLQDGLRRMAAHDFATRLNVQTHDEIGQLTQGF
NRMAQELQSLYVDLESRVTQKTEQLGVHNRELSALYDITAFLNMAGDIDSMCRGFIQRVT
AQFRAAGGSIRVMDPDGQRLHLVASEGLPAELADAEHCMPADACLCGVAMRQDVVLLHDF
RPMPQPVRPEPAYRCERAGYTGVAVFQIKTQQAMLGTFSLHFRSEQQLPAGDVRLLETLG
QHLGIAIDHLRLSAKATQLAVIEERNLFAQGLHDSIAQGLNFLNLQVQLLDGAVQRQDLN
EAREIVPLLRFGVEESYQDVRELLLNFRTKLEQGTLRPAVEQTLARFARQTGITPDLRYE
ENGGAPLPAAQQLQVLFILQEALSNVRKHAVASRVAVSVINGRDFELHVEDDGRGYDEHE
VAERAQAHVGLSIMRERAAYLSAQLRLEGRPGKGTTVILRLQEQQRQAA