Protein Info for RALBFv3_RS16665 in Ralstonia solanacearum IBSBF1503

Annotation: GGDEF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 85 to 102 (18 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 212 to 232 (21 residues), see Phobius details amino acids 238 to 258 (21 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 301 to 466 (166 residues), 177.2 bits, see alignment E=1.1e-56 PF00990: GGDEF" amino acids 305 to 463 (159 residues), 159.4 bits, see alignment E=3.4e-51

Best Hits

KEGG orthology group: None (inferred from 74% identity to bur:Bcep18194_C6727)

Predicted SEED Role

"FOG: GGDEF domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (467 amino acids)

>RALBFv3_RS16665 GGDEF domain-containing protein (Ralstonia solanacearum IBSBF1503)
MSLDIAVPRPSAGIQWVTTIYTRLLLVGFAFIPAYLIAYLYVFQDPKLIFENHAFHEVAI
AAATLEGLFVTYVCWRCYRSSGEPLLRWLTLGFLGFSLIYAWHGVFTGMAHHNIWLFLLY
GPASRLIMAVLLFVGQLSYNRRSDGEAYRTNRHMWLGWLALFLAIDTGVAWIAYSPTAGS
PWVRVSMEGGALAFSAINVIALLTRRIRSPLMTIYGISVTAFALSSLAFILGRPWNHMWW
LAHAIFAAGFFLLSYGVVKAFQTTRSFSTIYSQEELMTRLGEAKAKTEDALRELQAAHHK
LEHLAATDPLTGLANRREFIGRVEAEIANANHAGAPFSVLALDLDRFKAINDTYGHQAGD
HVLQRFAKKCLEAIRPHDGVARVGGEEFMVLLPKVPLNTAHGIAERIRTVIAASPFELGP
GRAVPLTVSIGVSEFGRDGSDIDAILRSADERLYRAKHEGRNRVVAA