Protein Info for RALBFv3_RS16645 in Ralstonia solanacearum IBSBF1503

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 40 to 63 (24 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details PF05232: BTP" amino acids 7 to 69 (63 residues), 80.1 bits, see alignment E=5e-27 amino acids 74 to 137 (64 residues), 84.7 bits, see alignment E=1.7e-28

Best Hits

KEGG orthology group: None (inferred from 90% identity to rsl:RPSI07_mp1531)

Predicted SEED Role

"FIG00976329: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (145 amino acids)

>RALBFv3_RS16645 membrane protein (Ralstonia solanacearum IBSBF1503)
MSVPQKKPLERVLYALAFELIATLICAPLLSWLMGQPLAQMGALTILFALAAMAWNMVFN
AAFECIERRCGWARTLTVRAAHAVAFEGGLVVLLVPLGAWWLGVSLLEALLLDIGLMLFF
LPYTFFFNLAYDNLRARWVAGRALV