Protein Info for RALBFv3_RS15770 in Ralstonia solanacearum IBSBF1503

Annotation: asparaginase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR00520: L-asparaginase, type II" amino acids 2 to 318 (317 residues), 323.3 bits, see alignment E=8e-101 PF00710: Asparaginase" amino acids 7 to 199 (193 residues), 209.6 bits, see alignment E=3.3e-66 PF17763: Asparaginase_C" amino acids 220 to 321 (102 residues), 79.3 bits, see alignment E=2.3e-26

Best Hits

Swiss-Prot: 44% identical to ASPG_DICCH: L-asparaginase (ansB) from Dickeya chrysanthemi

KEGG orthology group: K01424, L-asparaginase [EC: 3.5.1.1] (inferred from 96% identity to rsc:RCFBP_20120)

Predicted SEED Role

"L-asparaginase (EC 3.5.1.1)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 3.5.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>RALBFv3_RS15770 asparaginase (Ralstonia solanacearum IBSBF1503)
MSSLPTIAILATGGTIAGSADDSASAARYRAGAVPIDQLLAASKLGLERVANVRAEQVAQ
IDSKDLTFDVWERLVARIRHWVDVERVDGVVITHGTDTLEETAMLLHLVVQTDVPIVMTA
AMRPSTSLSADGPLNLLNAVRAAANPASRGRGVLVALNQRVHAARDVQKGHTYAVEAFVS
PETGPLGFVLDAAVQYQRTTRLPDAADVLPMPPARQWPWVEVLSSYAQPDVRLVDTLAAA
GVRGLVIAATGAGSIHANLEAVLQQAAKQGVIVLRSTRTGAGVVPAHPDGQGWASSGALN
PYKARVLLMLLIAAGRARAETASLQQVIDRY