Protein Info for RALBFv3_RS15635 in Ralstonia solanacearum IBSBF1503

Annotation: cytochrome c oxidase accessory protein CcoG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 transmembrane" amino acids 46 to 66 (21 residues), see Phobius details amino acids 85 to 89 (5 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 203 to 222 (20 residues), see Phobius details amino acids 350 to 370 (21 residues), see Phobius details TIGR02745: cytochrome c oxidase accessory protein CcoG" amino acids 45 to 484 (440 residues), 493.5 bits, see alignment E=3e-152 PF12801: Fer4_5" amino acids 100 to 141 (42 residues), 37.7 bits, see alignment 5.5e-13 PF13746: Fer4_18" amino acids 223 to 329 (107 residues), 144.8 bits, see alignment E=4.3e-46 PF11614: FixG_C" amino acids 364 to 486 (123 residues), 112.3 bits, see alignment E=5.8e-36

Best Hits

KEGG orthology group: None (inferred from 98% identity to rsc:RCFBP_20147)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation" in subsystem Biogenesis of cbb3-type cytochrome c oxidases or Terminal cytochrome C oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (487 amino acids)

>RALBFv3_RS15635 cytochrome c oxidase accessory protein CcoG (Ralstonia solanacearum IBSBF1503)
MSENEPAWRPMSPANAVAGGQDAPTEQMLYEVRRKIYPRAVSGAFARWRVWLVLATQAVF
YGLPWLQWHGRQAVLFDLGARKFFLFGLVLWPQDVIYLTVLLVLSALSLFLFTAVAGRLF
CGYACPQTVYTEIFMWIERHIEGDRFARIRLDGERWSGRKLRLKAAKHSAWILIALWTGF
TFVGFFTPIRTLGAEVWTLSLGPWQTFWMLFYAFATWGNAGFMREQVCRYMCPYARFQSV
MVDRDTYVVTYDTERGEPRGSRSRSEDFAARGLGACVDCSICVQVCPTGIDIRQGLQYEC
IGCGACIDACDQVMDKMRYPRGLIRYTSERAMRDRLNSSEARRHLLRPRVLIYGGILATL
AAGLVVALALREPLKVDVIRDRGALAREVDGGKIENVYRLQLMNASEQPMRVTITAEGLP
QLEVQGGRGESTTLELAAAANRLVPIRVRRPADDIQPGSHKIRFVIQAERDGGSLVLHEP
SSFIVPR