Protein Info for RALBFv3_RS15450 in Ralstonia solanacearum IBSBF1503

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 transmembrane" amino acids 26 to 46 (21 residues), see Phobius details amino acids 58 to 81 (24 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 116 to 168 (53 residues), see Phobius details amino acids 181 to 205 (25 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 273 to 285 (13 residues), see Phobius details amino acids 287 to 287 (1 residues), see Phobius details amino acids 290 to 309 (20 residues), see Phobius details amino acids 315 to 333 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 60 to 329 (270 residues), 139.3 bits, see alignment E=7.1e-45

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 99% identity to rsc:RCFBP_20186)

Predicted SEED Role

"Inositol transport system permease protein" in subsystem Inositol catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>RALBFv3_RS15450 ABC transporter permease (Ralstonia solanacearum IBSBF1503)
MPPSLQTTIGTPAATPAPRRRLPQELSILLVLIGIALCFEVLGWIVRDRSFLYNPQGLLI
TILQVSEVGLLAIGVTLVIIAGGIDLSSGSVVALSAMVAASLAQMPDVANAVYPSLADLP
AVVPIAAGLIVGALAGLVNGALIVTTGIPAFIVTLGMMVSARGLARFYTHGQPVSMLTDS
YLWLGSGAKPVVVFLGAALVFHVVLRYTRFGKCIYAIGGNPVAARVSGINLNGTLVMVYT
LAGLLAGLGGVIASSRAQTGQSGMGMSYELDAIAAAVIGGTSLSGGVGRVTGTVIGALIL
GIISSGFTFLGVDAYIQEIIKGAIIVVAVVADRFRKRKRG