Protein Info for RALBFv3_RS15365 in Ralstonia solanacearum IBSBF1503

Annotation: ribose-5-phosphate isomerase RpiA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00021: ribose 5-phosphate isomerase A
  • amino acids 12 to 223 (212 residues), 216.2 bits, E=1.8e-68
• PF06026: Rib_5-P_isom_A
  • amino acids 53 to 222 (170 residues), 201.6 bits, E=3.6e-64

Best Hits

Swiss-Prot: 98% identical to RPIA_RALSO: Ribose-5-phosphate isomerase A (rpiA) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K01807, ribose 5-phosphate isomerase A [EC: 5.3.1.6] (inferred from 100% identity to rsc:RCFBP_20201)

MetaCyc: 62% identical to ribose-5-phosphate isomerase A (Escherichia coli K-12 substr. MG1655)
Ribose-5-phosphate isomerase. [EC: 5.3.1.6]

Predicted SEED Role

"Ribose 5-phosphate isomerase A (EC 5.3.1.6)" in subsystem Calvin-Benson cycle or D-ribose utilization or Pentose phosphate pathway (EC 5.3.1.6)

MetaCyc Pathways

• Bifidobacterium shunt (13/15 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• pentose phosphate pathway (7/8 steps found)
• Rubisco shunt (8/10 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• ethene biosynthesis V (engineered) (18/25 steps found)
• Calvin-Benson-Bassham cycle (9/13 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (6/9 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (17/26 steps found)
• oxygenic photosynthesis (10/17 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Carbon fixation in photosynthetic organisms
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.6

Protein Sequence (228 amino acids)

>RALBFv3_RS15365 ribose-5-phosphate isomerase RpiA (Ralstonia solanacearum IBSBF1503)
MTQDELKALVAQAAADYVLANVPEGAVLGVGTGSTANLFIDAMAPHKARFAGAVSSSEAS
TRRLQGHGFAVLDLNEVDTIPVYVDGADEIDDTGAMIKGGGGALTREKIVASVAGQFVCI
ADGSKLVDVLGAFPLPVEVVPMARAAVARQLAALGGQPRLRMTKEGQIYQTDNGNVILDV
VGLRIGEPKTLEAQINDIPGVVTVGLFAKRGANVLLLGTETGVQRRDF