Protein Info for RALBFv3_RS15170 in Ralstonia solanacearum IBSBF1503

Annotation: recombination protein RecR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 TIGR00615: recombination protein RecR" amino acids 8 to 204 (197 residues), 233.8 bits, see alignment E=5.8e-74 PF21176: RecR_HhH" amino acids 12 to 54 (43 residues), 82.5 bits, see alignment 3.7e-27 PF02132: RecR_ZnF" amino acids 58 to 78 (21 residues), 32 bits, see alignment (E = 2e-11) PF01751: Toprim" amino acids 85 to 176 (92 residues), 39.6 bits, see alignment E=1.2e-13 PF13662: Toprim_4" amino acids 85 to 179 (95 residues), 89.1 bits, see alignment E=4.5e-29 PF21175: RecR_C" amino acids 181 to 204 (24 residues), 44.8 bits, see alignment (E = 1.9e-15)

Best Hits

Swiss-Prot: 98% identical to RECR_RALSO: Recombination protein RecR (recR) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K06187, recombination protein RecR (inferred from 98% identity to rsc:RCFBP_20239)

MetaCyc: 55% identical to recombination mediator protein RecR (Escherichia coli K-12 substr. MG1655)
RXN0-2606

Predicted SEED Role

"Recombination protein RecR" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (206 amino acids)

>RALBFv3_RS15170 recombination protein RecR (Ralstonia solanacearum IBSBF1503)
MRGGAGTPSALQMLVEALRVLPGVGPKSAQRMAYHLLQHDREGASRLAEALAEAAESIRH
CSRCNTFTEQDVCETCLDPRRDASVLCVVETPADQMMIEQTLTYRGQYFVLMGRLSPLDN
IGPKEIHLERLLARATDPALGGPCAEVILATNFTSEGEATAHYIGEMLKARGIKVSRLAR
GVPVGGELEYVDAGTIARAVLDRRQL