Protein Info for RALBFv3_RS15045 in Ralstonia solanacearum IBSBF1503

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 transmembrane" amino acids 39 to 59 (21 residues), see Phobius details amino acids 163 to 188 (26 residues), see Phobius details amino acids 200 to 219 (20 residues), see Phobius details amino acids 224 to 242 (19 residues), see Phobius details amino acids 280 to 306 (27 residues), see Phobius details amino acids 326 to 348 (23 residues), see Phobius details PF12911: OppC_N" amino acids 25 to 62 (38 residues), 30.8 bits, see alignment 2.2e-11 PF00528: BPD_transp_1" amino acids 178 to 360 (183 residues), 109.8 bits, see alignment E=1.4e-35

Best Hits

Swiss-Prot: 50% identical to YEJE_ECOLI: Inner membrane ABC transporter permease protein YejE (yejE) from Escherichia coli (strain K12)

KEGG orthology group: K13895, microcin C transport system permease protein (inferred from 99% identity to rsc:RCFBP_20258)

MetaCyc: 50% identical to putative oligopeptide ABC transporter membrane subunit YejE (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]

Predicted SEED Role

"Oligopeptide transport system permease protein OppC (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (374 amino acids)

>RALBFv3_RS15045 ABC transporter permease (Ralstonia solanacearum IBSBF1503)
MTQYSRASVHASNTAAPHAIRHSPSPLRRAWQRFKQHRLGYWSLILFVALFVLSLLSEAI
SNDRPLVVKYHGQWYFPIVKIYPETTFDGDFTTPTDYLDPYIRDKFKAPGNFVLYPPNPY
SYETLNYFAKEPNPAPPSAENWLGTDDRGRDVFARLLYGFRVSVLFGLALTLIGVLVGTL
TGALMGFFGGRFDLVSQRLIEIWGSMPELYLLIIFASIFEPSLGLLIVLLSLFGWMGLSA
YVRAEFYRNRSLDYVKSARAMGLSDWQIIWRHILPNSLTSIITFLPFSMSAAILTLTSLD
FLGLGVPPSTPSLGELLAQGKANLDAWWISLSTFVTLVLILVLLTFMGDALRDAFDTRLS
FAQLRARQKPAGAK