Protein Info for RALBFv3_RS15020 in Ralstonia solanacearum IBSBF1503

Annotation: aspartate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 TIGR00656: aspartate kinase, monofunctional class" amino acids 1 to 413 (413 residues), 410.5 bits, see alignment E=7.9e-127 PF00696: AA_kinase" amino acids 3 to 229 (227 residues), 178.8 bits, see alignment E=2.2e-56 TIGR00657: aspartate kinase" amino acids 57 to 412 (356 residues), 373.1 bits, see alignment E=2.3e-115 PF01842: ACT" amino acids 275 to 328 (54 residues), 35.3 bits, see alignment 1.1e-12 amino acids 355 to 392 (38 residues), 28.1 bits, see alignment 2.1e-10 PF13840: ACT_7" amino acids 348 to 409 (62 residues), 67 bits, see alignment E=1.6e-22

Best Hits

KEGG orthology group: K00928, aspartate kinase [EC: 2.7.2.4] (inferred from 99% identity to rsc:RCFBP_20262)

Predicted SEED Role

"Aspartokinase (EC 2.7.2.4)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 2.7.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (416 amino acids)

>RALBFv3_RS15020 aspartate kinase (Ralstonia solanacearum IBSBF1503)
MALIVHKYGGTSMGSVERIKNVAKRVAKWHRAGHQIVVVPSAMSGETNRLLGMAKEISAQ
PDPRELDMIASTGEQVSVGLLAIALHAEGIDAISYTGWQVPVQTDSAYTKARIQSIDDER
VRADLEAGRVVVITGFQGIDGEGHITTLGRGGSDTSAVAVAAALEAEECLIYTDVDGVYT
TDPRVVDDARRLDKITFEEMLEMASLGSKVLQIRSVEFAGKYRVKTRVLSSLTDPLMPLE
VEMHSGTLITFEEDSNMEAAAISGIAFARDEAKITVIGVPDKPGIAYQILGPVADANIDV
DMIIQNQSVDGKTDFTFTVPRGDYQRALGILTDSVKGHVGAASVAGDPKVSKVSVVGVGM
RSHVGIASKMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKAFELDQA