Protein Info for RALBFv3_RS14920 in Ralstonia solanacearum IBSBF1503

Annotation: DNA mismatch repair protein MutS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 885 transmembrane" amino acids 233 to 258 (26 residues), see Phobius details amino acids 643 to 660 (18 residues), see Phobius details TIGR01070: DNA mismatch repair protein MutS" amino acids 21 to 878 (858 residues), 1062.4 bits, see alignment E=0 PF01624: MutS_I" amino acids 22 to 133 (112 residues), 145.6 bits, see alignment E=1.8e-46 PF05188: MutS_II" amino acids 142 to 268 (127 residues), 70.4 bits, see alignment E=5.1e-23 PF05192: MutS_III" amino acids 286 to 575 (290 residues), 166.8 bits, see alignment E=1.9e-52 PF05190: MutS_IV" amino acids 444 to 535 (92 residues), 109.2 bits, see alignment E=2.6e-35 PF00488: MutS_V" amino acids 625 to 811 (187 residues), 279.5 bits, see alignment E=4e-87

Best Hits

Swiss-Prot: 96% identical to MUTS_RALSO: DNA mismatch repair protein MutS (mutS) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03555, DNA mismatch repair protein MutS (inferred from 92% identity to rpf:Rpic12D_1089)

Predicted SEED Role

"DNA mismatch repair protein MutS" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (885 amino acids)

>RALBFv3_RS14920 DNA mismatch repair protein MutS (Ralstonia solanacearum IBSBF1503)
MAEHSAPALEIDPKYGPFDKHTPMMQQYLKLKSAHPHTLVFYRMGDFYELFFEDAEKAAR
LLDITLTSRGSTNGQPIRMAGVPFHAVEQYLAKLVKLGESAAICEQIGDPATTKGPVERK
VVRVVTPGTLTDAALLSDKVNNHLLAIAQIPGKRGAAPLVGLAWLNLVGGELRLMECSAD
QLDRELERIRPAEVLSDDATLSAIAYDVARTRLPDWHFDVEAGARRLREQLGVASLVAFG
AETLTAALAAAGALLNYAAATQGQSLRHVIGLTVEHESEFIGLDTATRRNLELTETLRGQ
ESPTLFSLLDTCSTSMGSRLLRHWLHHPLRDRAVPQARQQAIEVLLAGDWQSLRGTLRTL
SDVERITGRLALLSARPRDLSSLRDTLARLPEVRDQLPQSDAAPLLGDLHAALAIPEDAH
ALLQHAVMAEPAAMVRDGGVIARGYDADLDELRDISENCGQFLVDLEARERERTGIANLR
VEYNRVHGFYIEVTNGQAAKVPDDYRRRQTLKNAERYITPELKTFEDKALSAQDRALSRE
KSLYEDLLQKLLPHLPAFKRIAAALAQADVLATLAERAHALSWSCPALTDAPGIELIRAR
HPVVEQQVEQFVANDCVLQETRKLLLITGPNMGGKSTFMRQTALVVLLAYVGAFVPADAA
TIGPIDRIFTRIGAADDLAGGRSTFMVEMTEAAAILHRATPNSLVLMDEIGRGTSTFDGL
ALAWAIARHLLSHNRSHTLFATHYFELTQLPQEFAQASNVHLSAVEHGDGIVFLHAVQEG
PASQSYGLQVAQLAGVPQPVIRAARKRLAWLEQHSADTGATPQLDLFALPGDPSDDDDDD
ATEAAAPAASSALTEALADIDPDAMTPREALDVLYRLKALSDTST