Protein Info for RALBFv3_RS14870 in Ralstonia solanacearum IBSBF1503

Annotation: threonylcarbamoyl-AMP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00057: tRNA threonylcarbamoyl adenosine modification protein, Sua5/YciO/YrdC/YwlC family
  • amino acids 7 to 200 (194 residues), 190.3 bits, E=1.1e-60
• PF01300: Sua5_yciO_yrdC
  • amino acids 22 to 198 (177 residues), 164 bits, E=1.3e-52

Best Hits

Swiss-Prot: 55% identical to YCIO_ECOL6: Uncharacterized protein YciO (yciO) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K07566, putative translation factor (inferred from 98% identity to rsl:RPSI07_2235)

Predicted SEED Role

"Hypothetical YciO protein, TsaC/YrdC paralog"

Protein Sequence (207 amino acids)

>RALBFv3_RS14870 threonylcarbamoyl-AMP synthase (Ralstonia solanacearum IBSBF1503)
MSQFFQIHPTTPQGRLIRQAAEIIRAGGLVALPTDSCYALACHLDDKAAVERLRRVRGID
EKHHLTLMCRDLSELATFARVDNKQYRVVKAATPGPFVFLLEATKEVPRRLSHPSRKTIG
LRVPEHPIPLALMAELGEPLLSATLQLPGDDAPLNEAETIRARLERQLELVIDGGPAPAE
PTTVIDLTGGEPELVRQGRGDPAWVGL