Protein Info for RALBFv3_RS14630 in Ralstonia solanacearum IBSBF1503

Annotation: salicylate-5-hydroxylase small oxygenase NagH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13577: SnoaL_4
  • amino acids 7 to 140 (134 residues), 59.1 bits, E=4.7e-20
• PF00866: Ring_hydroxyl_B
  • amino acids 18 to 150 (133 residues), 48.9 bits, E=7.8e-17

Best Hits

Swiss-Prot: 61% identical to NAGH_RALSP: Salicylate 5-hydroxylase, small oxygenase component (nagH) from Ralstonia sp.

KEGG orthology group: K05709, small terminal subunit of phenylpropionate dioxygenase [EC: 1.14.12.19] (inferred from 96% identity to rso:RSc1089)

MetaCyc: 61% identical to salicylate-5-hydroxylase small subunit (Ralstonia sp. U2)
RXN-10446 [EC: 1.14.13.172]

Predicted SEED Role

"Ortho-halobenzoate 1,2-dioxygenase beta-ISP protein OhbA" in subsystem Benzoate degradation

MetaCyc Pathways

• salicylate degradation II (1/1 steps found)
• salicylate glucosides biosynthesis II (1/2 steps found)
• 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation to 2-hydroxypentadienoate (2/5 steps found)
• cinnamate and 3-hydroxycinnamate degradation to 2-hydroxypentadienoate (2/5 steps found)
• 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation (2/8 steps found)

KEGG Metabolic Maps

• Phenylalanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.19

Use Curated BLAST to search for 1.14.12.19 or 1.14.13.172

Protein Sequence (157 amino acids)

>RALBFv3_RS14630 salicylate-5-hydroxylase small oxygenase NagH (Ralstonia solanacearum IBSBF1503)
MLDFATYQQLLDLYTRYAAAVDNGDWHAWPEFFLDDCIYRIQPRENHERGYPLATLSLES
KGMLKDRVYGMTETIFHDPYYQRHVIGLPQVTRVEGDRIEAQANYAVFRTKPDELSTVFN
VGRYIDAIVRTDDGLKLASRLCVFDSEMIPNSIIYPI