Protein Info for RALBFv3_RS14625 in Ralstonia solanacearum IBSBF1503
Annotation: non-heme iron oxygenase ferredoxin subunit
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 57% identical to NAGAB_RALSP: Naphthalene 1,2-dioxygenase/salicylate 5-hydroxylase systems, ferredoxin component (nagAb) from Ralstonia sp.
KEGG orthology group: K14578, naphthalene 1,2-dioxygenase system ferredoxin subunit (inferred from 91% identity to rsl:RPSI07_2303)MetaCyc: 58% identical to 2-nitrotoluene dioxygenase complex ferredoxin component (Acidovorax sp. JS42)
RXN-8819 [EC: 1.14.12.23]
Predicted SEED Role
"Probable ferredoxin subunit of a ring-hydroxylating dioxygenase oxidoreductase protein (EC 1.-.-.-)" (EC 1.-.-.-)
MetaCyc Pathways
- 2-nitrotoluene degradation (1/3 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Carotenoid biosynthesis - General
- Insect hormone biosynthesis
- Nucleotide sugars metabolism
- Porphyrin and chlorophyll metabolism
- Puromycin biosynthesis
- Trinitrotoluene degradation
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.-.-.-
Use Curated BLAST to search for 1.-.-.- or 1.14.12.23
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (103 amino acids)
>RALBFv3_RS14625 non-heme iron oxygenase ferredoxin subunit (Ralstonia solanacearum IBSBF1503) MTTTWLKLIPVSDLPDDDVVAVDAGAAEIALYQVAGEVFATDNLCTHGRARLCDGFLDGY EIECPLHQGKFDVRSGKAMCEPLSSDVRTYPIKIEDGHVFVEL