Protein Info for RALBFv3_RS14355 in Ralstonia solanacearum IBSBF1503

Annotation: molybdopterin molybdenumtransferase MoeA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 313 to 333 (21 residues), see Phobius details PF03453: MoeA_N" amino acids 19 to 185 (167 residues), 149.5 bits, see alignment E=9.8e-48 TIGR00177: molybdenum cofactor synthesis domain" amino acids 195 to 333 (139 residues), 106.9 bits, see alignment E=4.3e-35 PF00994: MoCF_biosynth" amino acids 200 to 337 (138 residues), 121.8 bits, see alignment E=2.9e-39 PF03454: MoeA_C" amino acids 357 to 424 (68 residues), 67.6 bits, see alignment E=1.4e-22

Best Hits

KEGG orthology group: K03750, molybdopterin biosynthesis protein MoeA (inferred from 96% identity to rsc:RCFBP_20443)

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (428 amino acids)

>RALBFv3_RS14355 molybdopterin molybdenumtransferase MoeA (Ralstonia solanacearum IBSBF1503)
MTTLASVVSCLSDYDPNALPVAQAQAIMRDFVQPVTGVAHVPIRSALDRVLAEDVLSSID
VPAHDNSAMDGFAFASAELSRDGSRDDLVLRVIGTAYAGTAFDGTPGPGEAVRVMTGAVM
PAGCDTVIPQEFTQGDTASVRFASDAVRAGDNRRLRGEDLAKGSAALAAGRILRPADIGL
LASLGIAEVPVRRRLRVAFFSTGDELRSIGEPLDAGCVYDSNRYTLHGMLSRLGVELIDM
GVVRDDPAALEAAFRTAAENADAIITSGGVSVGEADFTKQMMAQLGDVTFWKIAMRPGRP
MAFGRIASNSHGAFLFGLPGNPVAVMVTFYHFVRGALLRMMGAAETGAPLVPATSVAPIR
KRPGRTEYQRGIAALNGSGQLEVRLTGQQGSGVLRSMSEANCFVVLPHEQGQVNAGDTVH
LLLFDGLL