Protein Info for RALBFv3_RS14325 in Ralstonia solanacearum IBSBF1503

Annotation: nicotinate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01514: nicotinate phosphoribosyltransferase
  • amino acids 17 to 402 (386 residues), 478.5 bits, E=8.6e-148
• PF17767: NAPRTase_N
  • amino acids 22 to 143 (122 residues), 122.2 bits, E=1.7e-39
• PF04095: NAPRTase
  • amino acids 178 to 403 (226 residues), 235.9 bits, E=5.7e-74

Best Hits

Swiss-Prot: 95% identical to PNCB_RALSO: Nicotinate phosphoribosyltransferase (pncB) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00763, nicotinate phosphoribosyltransferase [EC: 2.4.2.11] (inferred from 98% identity to rsc:RCFBP_20449)

Predicted SEED Role

"Nicotinate phosphoribosyltransferase (EC 2.4.2.11)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or Redox-dependent regulation of nucleus processes (EC 2.4.2.11)

MetaCyc Pathways

• NAD salvage pathway I (PNC VI cycle) (6/7 steps found)
• NAD salvage pathway V (PNC V cycle) (4/5 steps found)
• superpathway of NAD biosynthesis in eukaryotes (10/14 steps found)
• NAD salvage (plants) (6/11 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Nicotinate and nicotinamide metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.11

Use Curated BLAST to search for 2.4.2.11

Protein Sequence (404 amino acids)

>RALBFv3_RS14325 nicotinate phosphoribosyltransferase (Ralstonia solanacearum IBSBF1503)
MTAIPRAGAPLPAVPMIIRSLLDTDLYKFTMMQVVLHHFPGAHVEYRFKCRNPGIDLVPY
IDEIRAEIRHLCALRFTEAELGYLRGLRFIKSDFVDFLGLFHLNEKYIDIRPAASNDGQI
DIVISGPWLHTIMFEVPVLAIVNEVYFSRTQAHPQWDEGKRRLTEKLGSLTHPGLEDCRI
ADYGTRRRFSHTWHEHVLTETRSHLGSQYAGTSNVYFAMKHNMTPLGTMAHEYLQACQAL
GPRLRDSQVFALETWAREYRGDLGIALSDTYGFDAFLRDFDMYFCKLFDGVRHDSGDPFE
WGERMLKHYEDSRVGPQSKALIFSDSLDMPKVVRLYERFQGRCKLAFGVGTNLTNDLGYT
PLQIVIKMVRCNGQPVAKLSDAPEKTMCDDAAYLAYLKQVFGVQ