Protein Info for RALBFv3_RS14065 in Ralstonia solanacearum IBSBF1503

Annotation: chromate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 81 to 105 (25 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 150 to 178 (29 residues), see Phobius details PF02417: Chromate_transp" amino acids 13 to 176 (164 residues), 115.7 bits, see alignment E=1.2e-37

Best Hits

KEGG orthology group: K07240, chromate transporter (inferred from 99% identity to rsc:RCFBP_20501)

Predicted SEED Role

"Chromate transport protein ChrA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (181 amino acids)

>RALBFv3_RS14065 chromate transporter (Ralstonia solanacearum IBSBF1503)
MEGDAMSYLATLFDLFWHFVVLSFLAIGGASTTLPDMHRFLVDTRHYMTGEQLSAMYAIS
QAAPGPNVLFVELFGWQAAGLGGAVAAMLGICGPSCVIAGIVARVMHQAPDARWVTLIRR
GLAPLTIGLLFSTGWVLARATDHSVGTVALTAATVLACTFTRVHPLILVAAGALAGALGW
A