Protein Info for RALBFv3_RS14050 in Ralstonia solanacearum IBSBF1503

Annotation: lytic transglycosylase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01464: SLT
  • amino acids 109 to 215 (107 residues), 107.1 bits, E=2e-35

Best Hits

KEGG orthology group: None (inferred from 96% identity to rsc:RCFBP_20504)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase E (EC 3.2.1.-)" (EC 3.2.1.-)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Glycosaminoglycan degradation
• Nucleotide sugars metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Protein Sequence (282 amino acids)

>RALBFv3_RS14050 lytic transglycosylase domain-containing protein (Ralstonia solanacearum IBSBF1503)
MTRLRRSTLLMMALALLAGQPARADVYGYIDENGLAHFAASRLDDRYVLFMKGAAVAGES
GIAQPAGDPPEAEAYLNATRRDALDNAGMRQRLARAVLRHPNAPTVEPLIRQAAHRHGVD
PALVKAVIAAESGFNPQAVSPKGAIGLMQVIPETGERYGVTGDARRTLAQKLADPKINIA
TGVRYLSDLLRMFSGNLELVLAAYNAGEGAVQKHGNDIPPYAETQNYVKTVLQFYRYYNP
VAAVPGLMAVSAAGAMATRKPGRTGKPGRIELVLPASSLEQH