Protein Info for RALBFv3_RS13840 in Ralstonia solanacearum IBSBF1503

Annotation: methionine ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 22 to 170 (149 residues), 119.3 bits, E=3e-38
• PF09383: NIL
  • amino acids 273 to 344 (72 residues), 86.5 bits, E=1.3e-28

Best Hits

Swiss-Prot: 96% identical to METN_RALSO: Methionine import ATP-binding protein MetN (metN) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K02071, D-methionine transport system ATP-binding protein (inferred from 99% identity to rsc:RCFBP_20561)

Predicted SEED Role

"Methionine ABC transporter ATP-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Protein Sequence (349 amino acids)

>RALBFv3_RS13840 methionine ABC transporter ATP-binding protein (Ralstonia solanacearum IBSBF1503)
MIELKGISQHFRGAGGTDVHALRDVDLSIGKGEIFGIIGRSGAGKSTLVRVINLLNRPTS
GTVTVAGENLTTLDAGGLRQARRKIGMIFQHFNLLSSRTVYDNVALPLELAGTPRERIRE
IVLPLLELVGLAAHKDRYPAQISGGQKQRVGIARALASQPDVLLSDEATSALDPETTRSI
LDLLRKINRELGLTIVLITHQMEVIKQVCDRVAVLDAGRVVELGRVIDVFLKPKHDVTRA
LIGEVISQELPPSVLARVESRLVAREQGGRDHLFRLAFTGAGVDQPVLAQAIRHYGLDFN
ILHGHIDEIQGQAFGSLAILATGESADINNAMHFLREQGVVVEEINHVV