Protein Info for RALBFv3_RS13805 in Ralstonia solanacearum IBSBF1503

Annotation: UDP-glucose/GDP-mannose dehydrogenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR03026: nucleotide sugar dehydrogenase" amino acids 1 to 431 (431 residues), 443.1 bits, see alignment E=4.5e-137 PF03721: UDPG_MGDP_dh_N" amino acids 1 to 185 (185 residues), 216.1 bits, see alignment E=6.4e-68 PF02558: ApbA" amino acids 3 to 107 (105 residues), 24.1 bits, see alignment E=5e-09 PF00984: UDPG_MGDP_dh" amino acids 209 to 301 (93 residues), 124.6 bits, see alignment E=2.9e-40 PF03720: UDPG_MGDP_dh_C" amino acids 325 to 434 (110 residues), 112.1 bits, see alignment E=3.3e-36

Best Hits

KEGG orthology group: K00012, UDPglucose 6-dehydrogenase [EC: 1.1.1.22] (inferred from 98% identity to rsc:RCFBP_20568)

Predicted SEED Role

"UDP-glucose dehydrogenase (EC 1.1.1.22)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) or Teichuronic acid biosynthesis (EC 1.1.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.22

Use Curated BLAST to search for 1.1.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (457 amino acids)

>RALBFv3_RS13805 UDP-glucose/GDP-mannose dehydrogenase family protein (Ralstonia solanacearum IBSBF1503)
MRITIIGSGYVGLVTGACLAELGNDVFCLDVDQKKINLLNAGGVPIYEPGLKELIDRNRA
AGRLQFSTDVAASVAHGDVQFIAVGTPPDEDGSADLKYVLAAARNIAEHMDGFKVIVDKS
TVPVGTGDKVRAVVAEVLATRGKAGAGFSVVSNPEFLKEGAAVDDFMRPDRIVLGTYADE
AGQRAKATMRALYAPFNRNHERTFYMDVRSAEFTKYAANSMLATRISFMNEMANLADKVG
ADIELVRLGIGSDPRIGYSFLYAGTGYGGSCFPKDVQALVRTAQEYGQTLHVLEAVEAVN
DKQKEVLVGKIVDRLGEDLSGRTFAIWGLAFKPNTDDMREAPSRIVIAELLSRGARVRVY
DPVAMEEARLALAIDLSPEQLERVTFCAGQMDALKQADALVIVTEWKAFRSPDFNAVKAL
LKSPMVFDGRNLFEPHAMREAGFEYQAIGRSTQSSQQ