Protein Info for RALBFv3_RS12675 in Ralstonia solanacearum IBSBF1503

Annotation: EpsG family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details amino acids 130 to 195 (66 residues), see Phobius details amino acids 215 to 234 (20 residues), see Phobius details amino acids 239 to 257 (19 residues), see Phobius details amino acids 263 to 282 (20 residues), see Phobius details amino acids 291 to 310 (20 residues), see Phobius details PF14897: EpsG" amino acids 21 to 308 (288 residues), 73.1 bits, see alignment E=1.1e-24

Best Hits

KEGG orthology group: None (inferred from 86% identity to rsl:RPSI07_2663)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>RALBFv3_RS12675 EpsG family protein (Ralstonia solanacearum IBSBF1503)
MEMKATHKTISIAGTIFRVIPLLAIVLISALVAHRPPGLDKDYYGYLDYYGRVLAGETGF
VEPGFVVIARALNWLGGEYIDLLGIFCFCGLWAKHVAIRKFTTSSVGRLAAFWVVYACVF
FPLWELTQIRAGLAMGIVALALTSRSRLSSCALFLIAGMFHYSALVVFVFWGVATWFGVT
AFIWSVLVCAVVYLFQSRMPYFDVYSAKDYAESFNPFSLKSAFIFVMSACIGLFSWPRFA
RAIAFVAISMLLLYWSMPGMPSAAIRIADIALYLVVLALVASRNRTIDWGAWRFVMPLMC
AYFVYLNFFSPDAIIDVSAL