Protein Info for RALBFv3_RS12505 in Ralstonia solanacearum IBSBF1503

Annotation: pilus assembly protein TadB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 266 to 285 (20 residues), see Phobius details amino acids 298 to 319 (22 residues), see Phobius details PF00482: T2SSF" amino acids 158 to 282 (125 residues), 65.9 bits, see alignment E=1.8e-22

Best Hits

KEGG orthology group: K12510, tight adherence protein B (inferred from 96% identity to rsc:RCFBP_20763)

Predicted SEED Role

"Flp pilus assembly protein TadB" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>RALBFv3_RS12505 pilus assembly protein TadB (Ralstonia solanacearum IBSBF1503)
MDTLVIGFALSVFVAIVLGVSALYLWWDSSHSQTAKRLSQRLKMALLNSARHGGDESILK
QRVLAESPEVAAMLRRLPRIHQLDLILLQSGLNWSAGRFLALTLGLPVVVIVGVSPLDPP
WMATLALAVAAGSLPSFYVMYRRTRRLLRLEAQLPEATDLISRALRAGHSLPSALEMAGD
ELPQPIGPELAIVFGQINYGVSMNDALAGLIDRVPVDDLRYLVIAILIQRESGGNLAEIL
DNVGMLIRKRLQLLDKVRVLSAEGRLGGWILTALPPAMAVVVYQLNPELMSTLWKDPVGI
HMMWYAIAMTCFGVLWIRHIVRIHI