Protein Info for RALBFv3_RS12250 in Ralstonia solanacearum IBSBF1503

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 903 TIGR00229: PAS domain S-box protein" amino acids 28 to 148 (121 residues), 47.1 bits, see alignment E=2.4e-16 PF00989: PAS" amino acids 29 to 138 (110 residues), 38.9 bits, see alignment E=3.2e-13 amino acids 340 to 448 (109 residues), 23.7 bits, see alignment E=1.6e-08 PF13426: PAS_9" amino acids 38 to 139 (102 residues), 29.1 bits, see alignment E=3.9e-10 PF13185: GAF_2" amino acids 185 to 327 (143 residues), 44.9 bits, see alignment E=5.6e-15 PF01590: GAF" amino acids 188 to 326 (139 residues), 47.3 bits, see alignment E=1.3e-15 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 469 to 633 (165 residues), 156.3 bits, see alignment E=5.7e-50 PF00990: GGDEF" amino acids 473 to 630 (158 residues), 175.3 bits, see alignment E=3.3e-55 PF00563: EAL" amino acids 650 to 884 (235 residues), 246.3 bits, see alignment E=1.1e-76

Best Hits

KEGG orthology group: None (inferred from 98% identity to rsc:RCFBP_20886)

Predicted SEED Role

"FOG: PAS/PAC domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (903 amino acids)

>RALBFv3_RS12250 diguanylate cyclase (Ralstonia solanacearum IBSBF1503)
MDATSTERPGSPGTPEETAPGPLPLADDRYEALVRQMPDALYIVADDIIVFINEAGVRLL
GADSAHDIVGRELDAFIHEDSTQLARQRREWMIEHGAGLPPVEQTLLRCDGTPVEVEVLS
APVQLGWRTAVQVVARDIRQRKQAEQALRESEANYRALAAETARAKELLRCEKTVLELSS
RNVPLPGLLAEVCRIVEALLDDGAMCSILLCGDGEHVTLAVAPSLPAALSEALVGMAIGP
AVGSCGTAMFRNARVVVEDIETDPLWDGHRALVSPLGLRACWSTPIRGDNQQMIGTIAVY
YDTPCAPMRAAMQLLDDITDIVGVAVQKAHIVRELQDSEERYRLAVDNLTEGILVQSADG
TILACNPSARRILRAGDASPVGASHLMLMRRSLREDGSEIPVLERPTRVVLSTGRPLLGL
TIGLELVDGDVVWVYENVLPIMRPGDDTPSAVLISFNDIGPARAAEQQLKFLAQRDALTG
LYNRAYFLQRMQAVLDGAATDRRQVAVLFLDLDGFKKVNDTAGHEAGDHLLRIVAQRLSA
CVRQADTLARLGGDEFVVLLDHVRSLDEAERLARRIIAAIAQPFSTGGNEYYLGASIGIA
VHPEHGRDAATLLRCADAAMYNAKQNGRNQHRVFTERLSQRAQRRFQLEQHLRRALSAQE
LSLRYQPIVDAISMGIVGAEALLRWHSAELGDVSPAEFIPVAEDAGLITAIGEWVLEQAC
RQAAHWRNTCAPDFFIAVNLSPRQFGDGLVPTLSRCLAESGLPACALEMEITEGLLMRDT
AAVMPVLDALTALGVRISIDDFGTGYSSLSYLQRFPIDNLKVDRSFISGIPRHRDSVVIS
RAVVAMAASLDMTVTAEGVETLEQAEFLQAAGCDKLQGFLFGAPMTAAAYEERLRRGRSG
GPG