Protein Info for RALBFv3_RS12135 in Ralstonia solanacearum IBSBF1503

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 transmembrane" amino acids 32 to 48 (17 residues), see Phobius details amino acids 159 to 175 (17 residues), see Phobius details amino acids 195 to 213 (19 residues), see Phobius details PF00561: Abhydrolase_1" amino acids 82 to 324 (243 residues), 58.7 bits, see alignment E=3.7e-20

Best Hits

KEGG orthology group: K07019, (no description) (inferred from 96% identity to rsc:RCFBP_20911)

Predicted SEED Role

"Hydrolase, alpha/beta fold family functionally coupled to Phosphoribulokinase" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (374 amino acids)

>RALBFv3_RS12135 alpha/beta hydrolase (Ralstonia solanacearum IBSBF1503)
MTRPFRPAAPADLNLGALLAGPFEPHAFRSPWWLIGGNAQTIVPARLWRFPRIAYRRERW
DTPDGDFIDLDWTTHDADAHAPLVVLFHGLEGDSRSHYARLMMDALRARRWPGVVPHFRG
CSGEMNRAPRMYHSGDSAEIAWILDRLHRTHCAPHGRKLLAVGISLGGNMLLRYLGERGT
GVRHLSAAATVSAPLDMTAGGAALSQGFGLLYTRMFLRTLKQKAATKLDQHPGLYDREAM
LAARSFVEFDNLVTAPLHGYRDVYDYWTRASSKPVLRNVRVPALVLNARNDPFLPGRHLP
GPDEVSPDVVLDQPLHGGHVGFLQRRDGRLRHMPLAGRIDWLPARLLRFFDDVLGRPPRP
DTDEPPKRQGAGRG