Protein Info for RALBFv3_RS12000 in Ralstonia solanacearum IBSBF1503

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 513 transmembrane" amino acids 54 to 74 (21 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details PF08521: 2CSK_N" amino acids 59 to 201 (143 residues), 158.4 bits, see alignment E=2.4e-50 PF00672: HAMP" amino acids 226 to 274 (49 residues), 24.3 bits, see alignment 6.2e-09 PF00512: HisKA" amino acids 279 to 342 (64 residues), 58.4 bits, see alignment E=1.2e-19 PF02518: HATPase_c" amino acids 390 to 504 (115 residues), 89.2 bits, see alignment E=5.1e-29

Best Hits

KEGG orthology group: K07649, two-component system, OmpR family, sensor histidine kinase TctE [EC: 2.7.13.3] (inferred from 96% identity to rsc:RCFBP_20926)

Predicted SEED Role

"Two-component system sensor protein"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (513 amino acids)

>RALBFv3_RS12000 sensor histidine kinase (Ralstonia solanacearum IBSBF1503)
MGDRLAWPWRRPHAPPDGTVPEAGDRDLADTLPHLEDDATRPVARSLFGEILDWMLAPLL
LLWPMSIAVTYLVAKSIANAPYDRALESSAIVLSQQLREVNGRVTLQLPISAREILRADE
TDNIYYQVLGTHGEFVSGDRDLPLPPEEDTGAGGPVQLRDDRIHGAEIRVAYTYVQQPGD
RPALVQVAETLDKRAQLANEIIKGVILPQFVILPLAVILVWFGLTRGLAPLNAIQERIRA
RSPGDTSPIDEGAAPQELTPLVASFNELLGRLEQSVQTQKRFIADAAHQMKTPLAGLRMQ
AELAQREQSPDELRRTLAHIADSSDRTAHLVKQLLSLARMENMGATDGMAPLDLCALSRQ
VVAEWLPKAWAKQIDLGFEEPGAPVMTAGNATMLAEMLNNLLDNAIRYTPDGGRVTVRVT
TAPFEPFAFLDVEDTGPGIPVAERERVMQRFYRILGTQAEGSGLGLAIVREIVQQHGGDI
AVLDHVYQQSPRLAGAQFRITLPRCTPGEETSA