Protein Info for RALBFv3_RS11585 in Ralstonia solanacearum IBSBF1503

Annotation: glycerate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF13660: DUF4147" amino acids 12 to 234 (223 residues), 268.1 bits, see alignment E=6.2e-84 PF05161: MOFRL" amino acids 318 to 425 (108 residues), 114.4 bits, see alignment E=2.9e-37

Best Hits

KEGG orthology group: K00050, hydroxypyruvate reductase [EC: 1.1.1.81] (inferred from 98% identity to rsc:RCFBP_20996)

Predicted SEED Role

"D-glycerate 2-kinase (EC 2.7.1.-)" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism or Entner-Doudoroff Pathway (EC 2.7.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.81, 2.7.1.-

Use Curated BLAST to search for 1.1.1.81 or 2.7.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>RALBFv3_RS11585 glycerate kinase (Ralstonia solanacearum IBSBF1503)
MKLDRAAARALLLESYAAAVAAADPLKIVAGFLPPPHAAGRTLVVGAGKAAASMALAVER
AYAGRAQIEGLVVTRYAHGLPTRHIRVIEAGHPVPDEAGEQAAQTILDRVSALTERDRLI
VLVSGGGSSLLSLPAEGIPMSDLKAVTRELLRCGAPITDMNIVRKHLSRIQGGRLAAASR
APVTTLIVSDVAGDDPSAIASGPTVPDPSTYADALAILARWGAQAPETVRALLERGARGE
IVETPKPGDACFAPVTNHVIATAQQSLVAGAQVFAARGIHTAILGDTVTGEAREVAQVYG
ALARQIRQHGTPFAAPVALVSGGECTVTIPPGLTGGRGGRCAEFLLSLGIALEDMGDVYA
LAADTDGIDGSEDNAGALLDPQSIGRAAARGVAARVALDAHDAYGFFAAADDLIVTGPTR
TNVNDYRVILIL