Protein Info for RALBFv3_RS10985 in Ralstonia solanacearum IBSBF1503

Annotation: heme A synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 32 to 51 (20 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 267 to 287 (21 residues), see Phobius details amino acids 299 to 321 (23 residues), see Phobius details amino acids 327 to 348 (22 residues), see Phobius details PF02628: COX15-CtaA" amino acids 31 to 341 (311 residues), 296 bits, see alignment E=1.6e-92

Best Hits

KEGG orthology group: K02259, cytochrome c oxidase subunit XV assembly protein (inferred from 99% identity to rsc:RCFBP_21116)

Predicted SEED Role

"Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (363 amino acids)

>RALBFv3_RS10985 heme A synthase (Ralstonia solanacearum IBSBF1503)
MLLQLASIGILIALIPLCYVVVKGDRNKYRKLVWITAFLTLDLIMFGSFTRLTDSGLGCP
DWPGCYGTSNPFHASDDIHAAQAAMPTGPVTWMKAWIEMTHRYFALALGVLIITLVVLAW
VKRRELKQSPWYATAVLGLVCLQGAFGAWTVTLKLQPAIVVTHLLLGMSLLAALIWLGCK
NDAPRQVDSRGVSLRVPAAIGLALLVVQIALGGWVSTNYAVLACTDFPLCNGQWVPPMDF
AHGFTFWRELGRTAGGDFISHDALVAIHWTHRVFAAIVLSYLAWLGLRARRVAGTARVAT
VLLVVLAVQLATGLSNIVLGWPLPAAVAHNGGAAVLLLLMVRLHYLIGLAQARAPMPAAM
AAV