Protein Info for RALBFv3_RS10895 in Ralstonia solanacearum IBSBF1503

Annotation: S41 family peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 538 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details TIGR00225: C-terminal processing peptidase" amino acids 53 to 384 (332 residues), 318.6 bits, see alignment E=2.2e-99 PF13180: PDZ_2" amino acids 102 to 180 (79 residues), 56.6 bits, see alignment E=5.4e-19 PF00595: PDZ" amino acids 102 to 168 (67 residues), 41.3 bits, see alignment E=3.3e-14 PF17820: PDZ_6" amino acids 118 to 170 (53 residues), 41.5 bits, see alignment 1.9e-14 PF03572: Peptidase_S41" amino acids 200 to 381 (182 residues), 180.1 bits, see alignment E=5.1e-57

Best Hits

KEGG orthology group: K03797, carboxyl-terminal processing protease [EC: 3.4.21.102] (inferred from 99% identity to rsc:RCFBP_21135)

Predicted SEED Role

"Carboxyl-terminal protease (EC 3.4.21.102)" (EC 3.4.21.102)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.102

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (538 amino acids)

>RALBFv3_RS10895 S41 family peptidase (Ralstonia solanacearum IBSBF1503)
MRTSLKNISLIAIGLVTGVLATLQLSATAQNATVGPLPLEKLRLMADIFGQIKREYVEPV
DDDKLLTEAIKGMVASLDPHSAYLDKKDFQELQEGTQGRFAGLGIEISQEEGLVKVINPI
EDTPAFRAGVQPGDLITRIDDKPVRGMPLEQAVKRMRGAPGTKVTLTIYRKKEERTFPLT
ITRAEIQVQSVKAKLLGDGIAWVRITSFQERTVPDLAKRLNDLARQDAHLKGVILDLRNN
GGGVLQAAVGVSAAFLPPDVTVVSTNGQVPDAKRVYKANFANYRLSNFDTDPLVNLDPEF
KTVPIVVLTNAYTASASEIVAGALQDHHRAKTMGKTTFGKGSVQTVRPLSNDTGIKLTIA
YYYTPSGKSIQAKGIRPDVPVDQTPEGDPDDALITREIDTERHLHNKQESEEPEMTDREK
RRIEELRRLEEENAKKTPEQREKERNKKPIEFGSTDDFMLQQAIAELKGQPVKRSKSVLE
AVAAAPDKVLKSPAAKESSAPAKLLKGKTAPASEPAAPNPPSGPASGVIPAPEPTGAR