Protein Info for RALBFv3_RS10855 in Ralstonia solanacearum IBSBF1503

Annotation: glutamate--cysteine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 TIGR02049: glutamate--cysteine ligase" amino acids 17 to 425 (409 residues), 715.1 bits, see alignment E=1e-219 PF08886: GshA" amino acids 17 to 422 (406 residues), 661.4 bits, see alignment E=2e-203

Best Hits

KEGG orthology group: K01919, glutamate--cysteine ligase [EC: 6.3.2.2] (inferred from 99% identity to rso:RSc0344)

Predicted SEED Role

"Glutamate--cysteine ligase (EC 6.3.2.2), divergent, of Alpha- and Beta-proteobacteria type" in subsystem Glutathione: Biosynthesis and gamma-glutamyl cycle (EC 6.3.2.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>RALBFv3_RS10855 glutamate--cysteine ligase (Ralstonia solanacearum IBSBF1503)
MVPHLITALKGPLLELEQKILDATPAIERWFRLEWQEHTPPFYCSVDLRNAGFKLAPVDT
NLFPGGFNNLAPEMLPLAVQAAMAAIEKICPDAKNLLLIPERHTRNMFYLQNVARLSQIM
RQAGLNVRLGSLSDDIQEPTPIDLPDGQRLVVEPIKRIGTKDRRLGMDDFDPCSILLNND
LSAGVPPILENINEQYLLPPLHAGWSQRRKSNHFAAYDEVAKKFAKLIDIDPWMVNPYFA
KCNGIDFHERTGEDELAHAVETVLKKTAKKYKEYGIHETPYAVVKADAGTYGMGIMTVRD
PSEVRGLNRKERNKMSVVKEGLEVSEVIVQEGVHTFEKINEAVAEPVVYMIDRYVVGGFY
RVHTGRGIDENLNAPGMHFVPLPFASNSLPDSHAKPGAGEPNRFYMYGVVARLALLAASL
ELEKTDPNPLI