Protein Info for RALBFv3_RS10785 in Ralstonia solanacearum IBSBF1503

Annotation: dicarboxylate/amino acid:cation symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 41 to 65 (25 residues), see Phobius details amino acids 77 to 99 (23 residues), see Phobius details amino acids 150 to 168 (19 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 223 to 244 (22 residues), see Phobius details amino acids 307 to 327 (21 residues), see Phobius details amino acids 346 to 374 (29 residues), see Phobius details PF00375: SDF" amino acids 9 to 401 (393 residues), 373.4 bits, see alignment E=6.8e-116

Best Hits

Swiss-Prot: 96% identical to DCTA1_RALSO: C4-dicarboxylate transport protein 1 (dctA1) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K11103, aerobic C4-dicarboxylate transport protein (inferred from 99% identity to rsc:RCFBP_21157)

MetaCyc: 61% identical to C4 dicarboxylate/orotate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN-121A; TRANS-RXN-121C; TRANS-RXN-122A; TRANS-RXN0-451; TRANS-RXN0-517; TRANS-RXN0-553

Predicted SEED Role

"Aerobic C4-dicarboxylate transporter for fumarate, L-malate, D-malate, succunate, aspartate"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (428 amino acids)

>RALBFv3_RS10785 dicarboxylate/amino acid:cation symporter (Ralstonia solanacearum IBSBF1503)
MKKPFYKILYVQVLAAIAIGVILGHFEPKLAINMKPLGDGFIQLIKMVIGPIIFCTVVSG
IAGMRDMKKVGRVGGKALLYFEVVSTFALVIGLAAGHIFNPGSGFNVDVNSIDAKAVAQY
AAKAQSASTVEFLLNIIPSTIVDAFAKGDILQILLIALLFGSALSALGERAQMVTDFIDQ
IAKVLFRIVHVITRVAPIGAFGAMAFTIGKYGVVSLVPLLKLIGTFYLTAIIFVVVVLGT
IARLTGFSIFRFVAYIKEELLIVLGTSSSESALPHLMEKMEKLGCSKSVVGLVVPTGYSF
NLDGTNIYMTMAVIFISQALNIELTWTQQLTILAVAMLTSKGASGITGAGFITLAATLAV
VPTIPVAGMVLILGIDRFMSECRALTNITGNGVACVVISAWERELDRAKLARVMAGERGD
TVSATPAA