Protein Info for RALBFv3_RS10465 in Ralstonia solanacearum IBSBF1503

Annotation: biotin synthase BioB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 TIGR00433: biotin synthase" amino acids 35 to 330 (296 residues), 412.7 bits, see alignment E=4.4e-128 PF04055: Radical_SAM" amino acids 68 to 225 (158 residues), 83.5 bits, see alignment E=2e-27 PF06968: BATS" amino acids 240 to 330 (91 residues), 106.6 bits, see alignment E=6e-35

Best Hits

Swiss-Prot: 97% identical to BIOB_RALSO: Biotin synthase (bioB) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K01012, biotin synthetase [EC: 2.8.1.6] (inferred from 98% identity to rsc:RCFBP_21227)

MetaCyc: 66% identical to biotin synthase (Escherichia coli K-12 substr. MG1655)
Biotin synthase. [EC: 2.8.1.6]

Predicted SEED Role

"Biotin synthase (EC 2.8.1.6)" in subsystem Biotin biosynthesis (EC 2.8.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (359 amino acids)

>RALBFv3_RS10465 biotin synthase BioB (Ralstonia solanacearum IBSBF1503)
MQHAPLNFVPDAAKVPPVPGQNPNARWSREAIEALFALPFNDLLFQAQQVHRANFDANAV
QLSTLLSIKTGGCPEDCSYCPQSARYDTGVEAEKLMPIDAVLEAAARARQNGASRFCMGA
AWRNPKPHQLDAVADMVRGVKAMGLETCVTLGMLKQEQAQQLKDAGLDYYNHNLDTAPEF
YGEIITTRTYQDRLDTLGHVRDAGINVCCGGIVGLGESRHERAGLVAELANMEPYPDSVP
INNLVKVEGTPLAGNEALDPFEFVRTIAVARITMPKAMVRLSAGREAMDDALQALCFMAG
ANSIFYGEKLLTTDNPEADADRKLLARLGMRVEVQDHLHQADTGHSHSSHCHIDITPAD