Protein Info for RALBFv3_RS10390 in Ralstonia solanacearum IBSBF1503

Annotation: N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 PF00583: Acetyltransf_1" amino acids 65 to 151 (87 residues), 43.2 bits, see alignment E=9.1e-15 PF13508: Acetyltransf_7" amino acids 68 to 152 (85 residues), 37.9 bits, see alignment E=3.9e-13 PF08445: FR47" amino acids 96 to 153 (58 residues), 22.3 bits, see alignment E=2.1e-08 PF13673: Acetyltransf_10" amino acids 97 to 156 (60 residues), 25.9 bits, see alignment E=1.7e-09

Best Hits

KEGG orthology group: None (inferred from 96% identity to rsc:RCFBP_21241)

Predicted SEED Role

"GCN5-related N-acetyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (183 amino acids)

>RALBFv3_RS10390 N-acetyltransferase (Ralstonia solanacearum IBSBF1503)
MSLVDDLTTVRRIGPNEAAACAQALADVLIDCVEGGASVSFMLPLSREKALAFWRGVADG
VARGERALLIAEGEAGTVLGTVQLVLAQPENQPHRADVAKMLVHRRARRRGVAQRLMAEV
EAVARTEGKSVLVLDTVTGGDAERLYQRAGWQRVGTVPNYARMPDGALCGTTFYCKQLAV
PTA