Protein Info for RALBFv3_RS10225 in Ralstonia solanacearum IBSBF1503

Annotation: short-chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 2 to 191 (190 residues), 117.3 bits, E=9.4e-38
• PF08659: KR
  • amino acids 4 to 168 (165 residues), 31.6 bits, E=2.3e-11
• PF13561: adh_short_C2
  • amino acids 8 to 193 (186 residues), 93.1 bits, E=3.2e-30

Best Hits

Swiss-Prot: 37% identical to Y2073_MYCTU: Uncharacterized oxidoreductase Rv2073c (Rv2073c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 97% identity to rsc:RCFBP_21282)

Predicted SEED Role

"Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140)" in subsystem D-Sorbitol(D-Glucitol) and L-Sorbose Utilization (EC 1.1.1.140)

MetaCyc Pathways

• hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
• D-sorbitol degradation II (1/1 steps found)
• superpathway of hexitol degradation (bacteria) (13/18 steps found)
• L-sorbose degradation (1/2 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.140

Protein Sequence (246 amino acids)

>RALBFv3_RS10225 short-chain dehydrogenase (Ralstonia solanacearum IBSBF1503)
MKNILIVGATSAIAVACARQWATEGARFFLVARNGERLKQVADDLSTRGAQLAGRHQLDI
NSLEHHADMLEQCVGALGTIDIVLVAPGTLPDQAACQADPAVAVREFNTNATSVIALLTR
IANTLEAQRRGALAVISSVAADRGRPSNYLYGSAKAALSAFCEGLNARLFKAGVHVLTIK
PGFVSTPMTEGLPLPGPLVASPEKVAGDIVRAIGKRKDTLYTPWFWSIIMLIIRSVPKPV
FKRTSL